Home

Homemade Organic Berry Sorbet Ice Cream

  • <%= message %>
Homemade Organic Berry Sorbet Ice Cream 64239
fotolia-watermark-notice
  • <%= image %>
    • <%= img_src %>

    Art painting Homemade Organic Berry Sorbet Ice Cream

    Pattern no.:F69791813
    Designed by:© Brent Hofacker
    canvas printcanvas art printsweetredfreshsummergreenfreshnesshealthypinkfruitdairycoldglacéicefoodberryhomemadedessertsnacktastydeliciousrefreshmentportioncreamstrawberrymintepicurescoopblackberryraspberryblueberryice creamsherbetgelatosorbet
    show more tags+
    <% var discountval = Math.round(100*(discountprice.replace(",",".") - price.replace(",",".") ))/100 %>
    • Dimensions<%= dimensions.w %> x <%= dimensions.h %>cmChange
    • Parts dimensionsrozwińzwiń<%= parts %> cm
    • Technique<%= techniqueLabel %>
    • Stretcher bars<%= loomLabel %>
    Accessories: No Change
    Product available
    • £24.90
    • <%- discountprice %>
    All prices include tax!
    Shipping time
    Masz pytania odnośnie zamówienia?
    Dzwoń (+48) 71 707 03 46
    (od pon. do pt. w godzinach 09.00-15.00)
    [email protected]
    Technique
    Select dimensions
    Standard dimensions
    Custom dimensions
     
    Stretcher bars
    Select accessories

    Metal hooks - make it easier to accurately mount a painting on the wall

    hit
    Hooks Placement on the wall a lot easier!
    £0.82 pcs.
    to cart
    remove from the cart
    (We recommend the purchase 1 pcs.)
     

    Metal hooks - make it easier to accurately mount a painting on the wall

    Durable nails are an essential element in painting installation.

    Nails Essential assembly elements!
    £1.65 pcs.
    to cart
    remove from the cart
    (We recommend the purchase 1 pcs.)
     

    Durable nails are an essential element in painting installation.

    UV technology protects the painting from harmful activity of sunlight and moisture, makes colours are more durable and clearer.

    UV print Protects the painting.
    £4.90
    to cart
    remove from the cart
     

    UV technology protects the painting from harmful activity of sunlight and moisture, makes colours are more durable and clearer.

    Is a service that shortens the delivery time. Your order will be processed on a priority basis.

    Express service If the time counts!
    £8.22
    to cart
    remove from the cart
     

    Is a service that shortens the delivery time. Your order will be processed on a priority basis.

    Varnish protects handmande paintings - great presentation for many years!

    Varnish Protects handmande paintings.
    £7.89
    to cart
    remove from the cart
     

    Varnish protects handmande paintings - great presentation for many years!

    dystans

    dystans Niezbędne do montażu płyty na plexi. Metalowe dystanse zapewnią elegancki wygląd i wyeksponują obraz.
    £9.93 pcs.
    to cart
    remove from the cart
    (We recommend the purchase 1 pcs.)
     

    dystans

    Personal dedication will be placed at the back of the picture. It's the perfect gift idea!

    Personal dedication Placed at the back of the picture.
    £4.14
    Placed at the back of the picture.
     

    Personal dedication will be placed at the back of the picture. It's the perfect gift idea!

    to cart
    remove from the cart
  • dedykacja
    • Available techniques
    Premium Canvas Print ®
    Premium Canvas Print is an original technique developed especially to Bimago customers. The highest resolution print is covered with clear, structural varnish so that the canvas gains a unique texture and gloss typically found on oil paintings. Moreover the color is additionally strengthened and the pigment becomes more resistant to moisture and UV light. Imposing varnish is made manually by skilled painters who accurately reproduce traces of the brush or spatula on a canvas. In order to make the painting's texture as natural as possible we use the best products on the market - a Spanish acrylic gel, which is durable and absolutely safe. You will see and feel the difference!
    Canvas print
    When ordering a canvas print you are getting, not only the most popular wall decoration. When you receive an ordered canvas print you can immediately hang it on your wall - the edges of the stretcher bars are finished off and covered with canvas so you won't need any additional framing. You will receive your painting printed on the best Italian canvas. We are using large format printers produced by a reputable Swiss company – Zünd with print resolution: up to 360 dpi. As a result, the pattern can be mapped with true Swiss precision. Printing properties are comparable to quality achieved at the best digital laboratories making sure the canvas print will be a beautiful decoration in your home.
    Select stretcher bars
    Wooden
    stretcher bars (2cm)
    Eco pine stretcher bars

    In order to always make your painting beautifully presented (even without additional frameworks) - we fasten the canvas on a matched stretcher bar made of natural, solid pine wood - standard version thickness is 2 cm.

    We recommend those stretcher bars especially for:
    • multipart paintings,
    • small and medium-sized apartments,
    • walls containing other decorations
    3D Gallery
    stretcher bars (2.8 cm)
    an additional 3D effect

    Thicker stretcher bars are perfect for paintings with larger sizes, especially dedicated for the spacious interiors.

    We recommend this stretcher bars especially for:
    • one piece and square paintings,
    • paintings in large formats,
    • simple, minimalist interiors
    Maxx
    stretcher bars (4 cm)
    Maximum visibility of the painting

    If you want the painting to be an expressive decoration of the apartment you should choose a solid stretcher bars with 4 cm thickness. It's made of the highest quality pine wood which guarantees maximum exposure on your wall.

    We recommend this stretcher bars especially for:
    • paintings that will be the only or the dominant decoration,
    • very spacious interiors (lofts, hotel lobbies, conference rooms)
    Shipping cost
    Check shipping cost
    Shipping time
    Canvas prints
    7-8 days
    (working)
    Premium Canvas Prints ®
    7-8 days
    (working)
    Handmade paintings
    19-20 days
    (working)

    "Homemade Organic Berry Sorbet Ice Cream" painting

    Canvas Art Print “Homemade Organic Berry Sorbet Ice Cream” - and other canvas prints from Canvas Art Print category will decorate your interior space in interesting way. They are mostly used to decorate home (especially bedroom and living room, but also hall, dining room or kitchen), they give great effect also in other interiors like: offices, restaurants, waiting rooms.

    "Homemade Organic Berry Sorbet Ice Cream" canvas painting consists from 1 parts. Original, pink motif will surely match to interiors kept in similar colours. "Homemade Organic Berry Sorbet Ice Cream" acrylic painting will be great as a gift for every home decoration lover interested in motifs like: [product_tags].

    Products from bimago gallery are available in form of canvas printed by Premium Print technique, digital canvas print or hand painted canvas made by our artists. "Homemade Organic Berry Sorbet Ice Cream" paintingproduced using Premium Print technique with gel liner will give "Homemade Organic Berry Sorbet Ice Cream" unique, artistic look.

    Customer Comments

    £0.00
    Gift card gift card see more

    +44 208 089 0560

    Questions?

    The customer support is available on Monday to Friday, at 8:00-14:00.

    Polish English German French Spanish Italian Swedish Portugal Russian Czech Netherlands British
    Switch language
    Copyright © 2018 bimago. All Rights Reserved.